DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxl1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:308 Identity:120/308 - (38%)
Similarity:153/308 - (49%) Gaps:82/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GLPISF-----LHNSHR---PEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQ 133
            |||::|     |....|   |:|||:||||||||||..||.||:||:|||:||||:||:|.:|:|
  Rat    27 GLPLAFAPATALAGPGRVEPPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQ 91

  Fly   134 GWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCG 198
            |||||||||||||:||||:||:|.      ..||||||.||....||||.||||||:.:.:...|
  Rat    92 GWQNSIRHNLSLNECFVKVPREKG------RPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAG 150

  Fly   199 HP----NRYE-RESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLG 258
            .|    .|.| |||....:.|:.:.|..|...||               ||..       |.:.|
  Rat   151 SPEAKRTRVEPRESEVGCDVGSPNLATARPMHEP---------------DRSQ-------SPAAG 193

  Fly   259 FNSLFNNEARGLR---PLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSS 320
                  ..||...   |.||:|:  .|.|.:...:.|:.|. :|...:|.|.        ....|
  Rat   194 ------GTARSALLPWPGPELRD--PDADRTIQDAGAVASG-QLERPVHYPV--------HHLGS 241

  Fly   321 SGAPVLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTIDNIIG---KP 365
            |..|              ||..||..|.::|    |:||:|:.   ||
  Rat   242 SLRP--------------APSGSPKGSKSKS----FSIDSILAVRPKP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 63/93 (68%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 63/93 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349607
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2284
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.