DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxf1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_006255786.2 Gene:Foxf1 / 687536 RGDID:1584229 Length:447 Species:Rattus norvegicus


Alignment Length:306 Identity:92/306 - (30%)
Similarity:132/306 - (43%) Gaps:89/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            ||||||:||||||.|||.|:|::|||||.||:|:..:||::|...|||:||:|||||||:||:|:
  Rat   114 RPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKL 178

  Fly   153 PRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHC---------------GH--- 199
            |:...      ..|||.||.:|.::..|||:|::|||....:|.|               .|   
  Rat   179 PKGLG------RPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPD 237

  Fly   200 -------------PNRYERESG------------------------KDSNDGNS-------SAA- 219
                         ||....|.|                        ..||.|:|       ||| 
  Rat   238 TYGFQGSGGLSCAPNSLALEGGLGMMNGHLTGNVDGMALPSHSVPHLPSNGGHSYMGGCGGSAAG 302

  Fly   220 -----EIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGF----NSLFNNEARGLRPLPE 275
                 :...|:.||         .|..:..:.:.|..|.|.:..:    ::..|:.|..::..| 
  Rat   303 EYPHHDSSVPASPL---------LPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQP- 357

  Fly   276 IREC-PDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSS 320
            :..| |.....|.|.|........||:..|:..|....:.|..:.|
  Rat   358 LSPCNPAANPLSGSISTHSLDQPYLHQNSHNGPAELQGIPRYHSQS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 50/93 (54%)
Foxf1XP_006255786.2 FH_FOXF1 118..216 CDD:410823 53/103 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.