DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxl3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_038945901.1 Gene:Foxl3 / 680273 RGDID:1594158 Length:216 Species:Rattus norvegicus


Alignment Length:256 Identity:87/256 - (33%)
Similarity:111/256 - (43%) Gaps:80/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNL 143
            |........|..:|.:||||||||||..:|..|:||||||.|||.||||||.|::.|||||||||
  Rat    20 PAGSADEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNL 84

  Fly   144 SLNDCFVKIPRDKNTIEDNDSAGKGSYWMLD---SSASDMFEQGNYRRRRTRRQRHCGHPNRYER 205
            |||.||||:||    .|.:|. |||:||...   .|..|:||.||:||||.||            
  Rat    85 SLNSCFVKVPR----TEGHDK-GKGNYWTFAGGCESLLDLFENGNFRRRRRRR------------ 132

  Fly   206 ESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGL 270
                     ...:.|...|.:|                                      .||| 
  Rat   133 ---------GPKSEEAPGPLQP--------------------------------------AARG- 149

  Fly   271 RPLPEIRECPD-DVDASSSSSKAMQSSME-----------LHEELHSPSAFTPPLNRRETS 319
            .|.|:..:.|| :..|...:.:.::.|::           |....||..|..|.|..::.|
  Rat   150 SPGPDGTQAPDREAQARLVTHRDIKFSIDYILSSPDPFPVLRSSCHSQEARYPTLEPQQMS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 58/96 (60%)
Foxl3XP_038945901.1 Forkhead 32..115 CDD:395192 54/87 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.