DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXL2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:349 Identity:105/349 - (30%)
Similarity:156/349 - (44%) Gaps:83/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PDNEELVNSMLANPDYLRTQVSPN--PLAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNI 75
            |:.|:...::|| |:..||...|.  |.:|...||.|      |..:|                 
Human     6 PEPEDAAGALLA-PETGRTVKEPEGPPPSPGKGGGGG------GGTAP----------------- 46

  Fly    76 WGLPISFLHNSHRP---EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQN 137
                       .:|   :|||:||:|||||||..:..:||||||||::|:.|||:|.:||:||||
Human    47 -----------EKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQN 100

  Fly   138 SIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNR 202
            |||||||||:||:|:||      :.....||:||.||.:..||||:|||||||..::.....|..
Human   101 SIRHNLSLNECFIKVPR------EGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAH 159

  Fly   203 YERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEA 267
            ::...|.....|.:....:....            ...|.         ||:......|.|.|.:
Human   160 FQPGKGLFGAGGAAGGCGVAGAG------------ADGYG---------YLAPPKYLQSGFLNNS 203

  Fly   268 RGLRPLPE------IRECPDDVDASSSSSKAMQS------SMELHEELHSPSAFTPPLNRRETSS 320
               .|||:      ...|.....|:::::.|..:      :..:.:.|..|:|...|..|.: |.
Human   204 ---WPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQ-SM 264

  Fly   321 SGAPVLAEAFNGIKDVVDAPGSSP 344
            :..|.:..::||:.....||...|
Human   265 ALPPGVVNSYNGLGGPPAAPPPPP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 55/93 (59%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 16/81 (20%)
Forkhead 53..139 CDD:365978 53/91 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.