DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxq1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:360 Identity:101/360 - (28%)
Similarity:135/360 - (37%) Gaps:153/360 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ANGSMLPDNEELVNSMLANPDYLRTQVSP-NPLAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLA 70
            :.|:...|:.|:.       |..|||.|| .|.|.|..||.|...      .|            
  Rat    70 SGGASTQDDPEVT-------DGSRTQASPVGPCAGSVGGGEGARS------KP------------ 109

  Fly    71 LHNNIWGLPISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGW 135
                          .:.|| |||:||||||||||..:...||||:.|.:::|.|||::|.:..||
  Rat   110 --------------YTRRP-KPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGW 159

  Fly   136 QNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHP 200
            :||:||||||||||||:.||.:.     ..||.:||||:.::...|..|.:||||.|        
  Rat   160 RNSVRHNLSLNDCFVKVLRDPSR-----PWGKDNYWMLNPNSEYTFADGVFRRRRKR-------- 211

  Fly   201 NRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNN 265
                                       ||                   ||..:|.|         
  Rat   212 ---------------------------LS-------------------HRTTVSAS--------- 221

  Fly   266 EARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAF 330
               ||||    .|.|.....:...               :|:|.:.|:.|       :|...|  
  Rat   222 ---GLRP----EEAPPGPAGTPQP---------------APTAGSSPIAR-------SPARQE-- 255

  Fly   331 NGIKDVVDAPGSSPVASSNRSKTTLFTIDNIIGKP 365
                     .||||.:..:.|    |.||:|:.||
  Rat   256 ---------EGSSPASKFSSS----FAIDSILSKP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 48/93 (52%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 46/82 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.