DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxg1c

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:311 Identity:108/311 - (34%)
Similarity:141/311 - (45%) Gaps:70/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            :|:||||||.|||.|||..:|.:||||:|||:|||..|||||||:||||||||||||||.||||:
Zfish    87 KPDKPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYRENRQGWQNSIRHNLSLNKCFVKV 151

  Fly   153 PRDKNTIEDNDSAGKGSYWMLDSSASDMF---EQGNYRRRRTRRQRHCGHPNRYERESGKDSNDG 214
            ||      ..|..|||:|||||.|:.|:|   ..|..|||.|...|......|..|.|...::.|
Zfish   152 PR------HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTAASRAKLAMKRGARLSSTAASAG 210

  Fly   215 NSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEAR---GLRPLPEI 276
            .:.|.....|..|      |...:..:|......|..|.:      |:.:..||   .:.|..|.
Zfish   211 LAFAGSFYWPVPP------FVTLQHRHSSPAAAHHSNYAA------SVLSQSARHFSSVAPAAER 263

  Fly   277 RECPDDVDAS---------SSSSKAMQSSMELHEELHSPSAFTPPLNR----------------- 315
            ...|...:|:         :|||.:..:|..:...|.:|.:|....|:                 
Zfish   264 LLIPSSQEATYYGMGCEQMTSSSSSFSTSASVPLPLSAPCSFNLLSNQSSYFYSHQVPHTAGLSA 328

  Fly   316 --------RETSSSG-------APVLAEAFNGIKDVVDAPGSSP---VASS 348
                    .:||.||       :|..:|...|:  ..|.|...|   .|||
Zfish   329 WSQEESYLSKTSPSGQFFPGKPSPSSSEYIGGL--CTDIPSYFPHFNTASS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 62/96 (65%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 62/93 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.