DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and si:rp71-45k5.2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001038405.1 Gene:si:rp71-45k5.2 / 560783 ZFINID:ZDB-GENE-060503-753 Length:255 Species:Danio rerio


Alignment Length:106 Identity:35/106 - (33%)
Similarity:53/106 - (50%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SYIALIAMAISSAPNQRLTLSGIYKFIMDKF-PYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNT 158
            :|..|||.||..:|:::||    :|.||.|. |:....|:..:|:||..||.|.||||:|     
Zfish    31 TYTGLIAYAIQESPDKKLT----FKEIMTKLEPFVFGEKRSIENNIRVCLSSNKCFVKVP----- 86

  Fly   159 IEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGH 199
            ::.:....|.:||.:|       |.|...:...|..:|..|
Zfish    87 VDPDYPNPKKNYWKVD-------ENGITPKMLRRHFKHIMH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 31/90 (34%)
si:rp71-45k5.2NP_001038405.1 FH 31..102 CDD:294049 29/79 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.