DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxb2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_005162532.1 Gene:foxb2 / 559714 ZFINID:ZDB-GENE-081104-320 Length:318 Species:Danio rerio


Alignment Length:108 Identity:65/108 - (60%)
Similarity:76/108 - (70%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCF 149
            ||:..:|||:|||:|.||||.|...:.|.||.|||||||:|||||||.|.||||:|||||.||||
Zfish     7 NSYSDQKPPYSYISLTAMAIQSCSEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCF 71

  Fly   150 VKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTR 192
            :||||..      |..||||:|.|.....||||.|::.|||.|
Zfish    72 IKIPRRP------DQPGKGSFWALHPDCGDMFENGSFLRRRKR 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 58/93 (62%)
foxb2XP_005162532.1 FH 13..101 CDD:214627 58/93 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.