Sequence 1: | NP_001246609.1 | Gene: | FoxL1 / 38471 | FlyBaseID: | FBgn0004895 | Length: | 365 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011519062.1 | Gene: | FOXJ2 / 55810 | HGNCID: | 24818 | Length: | 591 | Species: | Homo sapiens |
Alignment Length: | 330 | Identity: | 92/330 - (27%) |
---|---|---|---|
Similarity: | 132/330 - (40%) | Gaps: | 116/330 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 HRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVK 151
Fly 152 IPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHP-------NRYERESGK 209
Fly 210 DSNDGNSSAAEIRSPSE------------------------------------------PL---- 228
Fly 229 SDFDIFCNERPNYSD---RITDLHRQYLSVSL-----GFNSLF------NN-------------- 265
Fly 266 ---EARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPS--AFTPPLNRRETSSSG--- 322
Fly 323 APVLA 327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FoxL1 | NP_001246609.1 | FH | 91..185 | CDD:214627 | 47/93 (51%) |
FOXJ2 | XP_011519062.1 | Forkhead | 66..143 | CDD:278670 | 45/82 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |