DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxh1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001017084.1 Gene:foxh1 / 549838 XenbaseID:XB-GENE-1194372 Length:515 Species:Xenopus tropicalis


Alignment Length:352 Identity:87/352 - (24%)
Similarity:135/352 - (38%) Gaps:108/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCF 149
            |.||..|||:||:|:||:.|.::|.:||.||.|.|.:...||:::.:..||::|||||||.||||
 Frog   104 NYHRYAKPPYSYLAMIALVIQNSPEKRLKLSQILKEVSTLFPFFKGDYMGWKDSIRHNLSSNDCF 168

  Fly   150 VKIPRDKNTIEDNDSAGKGSYWMLDSS-----------------ASDMFEQG-------NYRRRR 190
            .|:.:|....:     .||::|.:|.|                 .||.|.|.       ||    
 Frog   169 KKVLKDPGKPQ-----AKGNFWTVDVSRIPLDAMKLQNTALTRGGSDYFVQDLAPYILHNY---- 224

  Fly   191 TRRQRHCGHPNRYER--------------------ESGKDSNDGN--SSAAEIRSPSEPLSDFDI 233
                       :||.                    |....:|.|.  :::..|.|....|.|.|:
 Frog   225 -----------KYEHNVVVYAPHHMPSHASSLPLAEDPHQTNTGGKLNTSFMIDSLLNDLQDVDL 278

  Fly   234 FCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPL--PEIRECPDDVDASSSSSKAMQSS 296
                    .|...::..|.:|.::..|:::::     .||  |:.:...:......|:|.:..||
 Frog   279 --------PDVPRNIESQRISPAVAINNMWSS-----APLLYPQSKPTRNGRGPGFSASHSTYSS 330

  Fly   297 MELHEELHSPSAFTPPLNR------RETSSSGAPVLAEAFNGIKDVVDAPGSSPVASSNRS---- 351
            ........||..|.....|      |:|...|.|......:   |....| ||...:.|.|    
 Frog   331 SSSSISTISPVGFQETQERSEDLLGRQTQRLGFPTKRPRED---DGCSTP-SSDTDAGNYSPTEP 391

  Fly   352 --KTTLFTID-----------NIIGKP 365
              |..|.::|           |::..|
 Frog   392 PKKMPLLSLDLPTSYTKSVAPNVVAPP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 42/117 (36%)
foxh1NP_001017084.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..103
FH 110..188 CDD:238016 36/82 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..399 21/95 (22%)
SMAD-interaction domain (SID) 377..503 10/43 (23%)
Fast/FoxH1 motif 1 (FM1). /evidence=ECO:0000255 402..406 0/3 (0%)
Fast/FoxH1 motif 2 (FM2). /evidence=ECO:0000255 412..418 1/5 (20%)
SMAD-interaction motif (SIM) 467..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.