DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxi4.1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_012818282.1 Gene:foxi4.1 / 549541 XenbaseID:XB-GENE-5996107 Length:381 Species:Xenopus tropicalis


Alignment Length:352 Identity:110/352 - (31%)
Similarity:162/352 - (46%) Gaps:84/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YANGSMLPDNEELVNSMLANPDYLRTQVSPNPLAPSA-VGGAG-------MEGLMCGSFSPAFYY 62
            |.:...:...:.|.:|..| |:|.....:| |..|.. :||.|       :.|....||.|. .|
 Frog    34 YCDNFSMYHQQNLHSSQRA-PNYGIGDYAP-PTNPYLWLGGPGVSNSPSYLHGNSPASFMPP-SY 95

  Fly    63 QGIDSFLALHNNIWGLPISFLHNSHRPE-----KPPFSYIALIAMAISSAPNQRLTLSGIYKFIM 122
            :....||:..::..|..:|:|..:.:.|     :||:||.|||||||.:||.::||||.||:::.
 Frog    96 RSQRQFLSNSSSFCGTDLSWLSVASQEELLKVVRPPYSYSALIAMAIQNAPEKKLTLSQIYQYVA 160

  Fly   123 DKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYR 187
            |.||:|:.:|.||||||||||||||||.|:|||:      |..|||:||.||.:...||:.||:|
 Frog   161 DNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDE------DDPGKGNYWTLDPNCEKMFDNGNFR 219

  Fly   188 RRRTRRQRHCG--------------------------HPNRYERESGKDSNDGNSSAAEIRSPSE 226
            |:|.||.....                          .|:..|.|:..|.....|.:....||. 
 Frog   220 RKRKRRSDSSSAEAVTVKGEEGRPALGGKGGESPLMLTPSSPELEAASDGRKSTSPSGITSSPC- 283

  Fly   227 PLSDFDIFCNERPNYSDR----ITDLHRQYLSVSLGF-NSLFNNEARGLRPLPEIRECPDDVDAS 286
             |::|         :|..    .|.::||   :|:|. |.|......||              .|
 Frog   284 -LNNF---------FSSMTSLDTTSVNRQ---MSMGLVNELSQRNITGL--------------GS 321

  Fly   287 SSSSKAMQSSMELHE---ELHSPSAFT 310
            .:|....:.|::|.:   .|:.||.::
 Frog   322 FTSGSVAEPSVDLQDNSLHLNRPSYYS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 54/93 (58%)
foxi4.1XP_012818282.1 Forkhead 129..214 CDD:365978 53/90 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.