DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxi2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001016544.1 Gene:foxi2 / 549298 XenbaseID:XB-GENE-982122 Length:350 Species:Xenopus tropicalis


Alignment Length:337 Identity:107/337 - (31%)
Similarity:149/337 - (44%) Gaps:71/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NEELVNSMLANP-------DYLRTQVSPNP--------LAPSAVGGAGMEGLMCGSFSPAFYYQG 64
            |::|.....|.|       :|.....||.|        .:|...||:|      ..:.||.|..|
 Frog    16 NQQLPQRPAAPPALGYGRNEYSSPTASPYPWLNGPAMNSSPYLNGGSG------SPYFPAGYGGG 74

  Fly    65 IDSFLALHNNIWGLPISFLHNSHRPE-----KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDK 124
            ...|:...:........:|...::.:     :||:||.:||||||.:.|.::||||.||.::.:.
 Frog    75 QRQFIPPSSGFGVADFPWLSIPNQADLLKMVRPPYSYSSLIAMAIQNNPEKKLTLSQIYSYVAEN 139

  Fly   125 FPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRR 189
            ||:|:::|.||||||||||||||||.|:.||     ||| .|||:||.||.:...||:.||:||:
 Frog   140 FPFYKKSKAGWQNSIRHNLSLNDCFKKVARD-----DND-PGKGNYWTLDPNCEKMFDNGNFRRK 198

  Fly   190 RTRRQRHC-----GHPNRYERE-----SGKDSNDG-----NSSAAEIRSPSEP------LSDFDI 233
            |.|:....     |..:..::|     .|.||..|     .||.....|.|.|      |.....
 Frog   199 RKRKSESVEAGFDGDASEDKKELALKSLGSDSPRGASALEQSSYGTPESKSRPAGGLAALDSSHC 263

  Fly   234 FCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPL-------PEIRE--------CPDDV 283
            |.|...|.:..:.....::.|..||.   |:|....|..|       |:|.|        |....
 Frog   264 FTNFASNMNALMNVGAPRHFSARLGD---FSNSRHYLAELASCPISSPQISEPQTGSKVPCYPSK 325

  Fly   284 DASSSSSKAMQS 295
            .|||..:..|.|
 Frog   326 QASSLCTSVMNS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 52/93 (56%)
foxi2NP_001016544.1 Forkhead 106..192 CDD:278670 52/91 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.