DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxi3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:304 Identity:104/304 - (34%)
Similarity:139/304 - (45%) Gaps:66/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLAPSAVGGAGME---------GLMCGSFSPAFYYQGIDSFLALHNNIWGLPISFLHNSHRPEKP 92
            |..|.|..||.::         |...|...|:.......:..|....:..|.::...:..:..:|
  Rat    68 PPPPGAAPGAFLQPPAAPGTFAGAQRGFTQPSAAAPASPAGSAAPGELGWLSMASREDLMKMVRP 132

  Fly    93 PFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKN 157
            |:||.|||||||.|||.::||||.||:|:.|.||:|:.:|.||||||||||||||||.|:|||: 
  Rat   133 PYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRDE- 196

  Fly   158 TIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGH---PNRYERESGKDSNDGNSSAA 219
                 |..|||:||.||.:...||:.||:||:|.||.....:   |      ||...:||.||..
  Rat   197 -----DDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVP------SGTSKSDGQSSRL 250

  Fly   220 EIR------SPSEPLSDFDIFCNERPNYSDR------------------ITDLHRQYLSVSLGFN 260
            .:.      |||..|         ||:.|..                  .|.....:||   .||
  Rat   251 RVSGKLEGDSPSSML---------RPSQSPEPPEGTKSTASSPGASTLTSTPCLNTFLS---SFN 303

  Fly   261 SLFNNEA--RGLRPLPEIRECPDDVDASSS----SSKAMQSSME 298
            :|..|.:  ...|.||..|..|......||    |:....||::
  Rat   304 TLSVNASSMSTQRTLPGSRRHPGGTQLPSSTTFPSTSIPDSSLD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 56/93 (60%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 56/91 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4368
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.