DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxd3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001011383.1 Gene:foxd3 / 496851 XenbaseID:XB-GENE-487289 Length:369 Species:Xenopus tropicalis


Alignment Length:284 Identity:94/284 - (33%)
Similarity:126/284 - (44%) Gaps:84/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||||||.|||..:|.::||||||.:||.::||||||....||||||||||||||||||||:
 Frog    92 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 156

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAE 220
            ..      :.|||:||.||..:.|||:.|::.|||.|                            
 Frog   157 PG------NPGKGNYWTLDPQSEDMFDNGSFLRRRKR---------------------------- 187

  Fly   221 IRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEAR--GLRPLPEIRECPDDV 283
                         |..::|:.....|.|..|    |.|..||.....|  ||.|           
 Frog   188 -------------FKRQQPDSLREQTALMMQ----SFGAYSLAGPYGRPYGLHP----------- 224

  Fly   284 DASSSSSKAMQSSMELHEELHSPSAFTPP---------LNRRETSSSGAPVLAEAFNGIKDVVDA 339
             |:.:...|:|     :..:.......||         |:|:..||..:|.|....:.:...   
 Frog   225 -AAYTHPAALQ-----YPYIPPVGPMLPPAVPLLPSSELSRKAFSSQLSPSLQLQLSSLSST--- 280

  Fly   340 PGSSPVASSNRSKTTLFTIDNIIG 363
              ::.:..|..|....|:|:||||
 Frog   281 --AASIIKSEPSSRPSFSIENIIG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)
foxd3NP_001011383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89
Forkhead 92..177 CDD:365978 56/90 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.