DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxd1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:268 Identity:91/268 - (33%)
Similarity:131/268 - (48%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||||||.|||..:|.:|||||.|.:||.::||||||....||||||||||||||||||||:
 Frog    68 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 132

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAE 220
            ..      :.|||:||.||..::|||:.|::.|||.|.:|... |....||.|.           
 Frog   133 PG------NPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQA-PELVLREPGH----------- 179

  Fly   221 IRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDA 285
             ..|:...|.....|    .|..::...|..  |..:.|.          :...:.|:.|..:..
 Frog   180 -FLPASAYSYGPYSC----AYGIQLQPFHPH--SALIAFQ----------QQQQQARQQPPSLPP 227

  Fly   286 SSSSSKAMQSSMEL------HEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGIKDVVDA---PG 341
            .::.:....::.:|      :....||:|..|.|..:.:|:     ||.:...|:.::..   ||
 Frog   228 MAAPALMPPAAQDLSRTCTFYPHQLSPAALPPSLQSKSSSA-----LARSTFSIESIIGGDLNPG 287

  Fly   342 --SSPVAS 347
              :||.|:
 Frog   288 QCNSPKAA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Forkhead 68..153 CDD:365978 56/90 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.