DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxj1.2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001008143.1 Gene:foxj1.2 / 493505 XenbaseID:XB-GENE-919738 Length:371 Species:Xenopus tropicalis


Alignment Length:293 Identity:85/293 - (29%)
Similarity:123/293 - (41%) Gaps:89/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||..||.||:.::..::||||.||.:|...|.|||.....||||||||||||.||:|:||.
 Frog   109 KPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRG 173

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRR---------------------------TRR 193
            |      |..|||.:|.:|...:|||..|..:|||                           :..
 Frog   174 K------DEPGKGGFWQMDPRYADMFVNGVLKRRRMPASHLDPPRCNKAIAHHPYLPVSRPSSHH 232

  Fly   194 QRHC--GH--PNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLS 254
            .:|.  ||  ..|||:.        |.....:|:| |...| .:|..|.|.......||..|...
 Frog   233 MQHISGGHRQSRRYEKP--------NPVLPALRAP-ERQGD-ALFTPEDPLQGSNFDDLDLQTAL 287

  Fly   255 VSLGFNSLFNNEARGLRPLPEIRECPDDVDASS-SSSKAMQSSMELHEELHSPSAFTPPL--NRR 316
            :|:.:..                    |:.||: :|:....|.|:::.:       .||:  |..
 Frog   288 ISMCWEG--------------------DLAASNLNSTLTGTSGMDMNLQ-------DPPMQDNHW 325

  Fly   317 ETSSSG---------APVLAEAFNG---IKDVV 337
            ..|:.|         .||:.:.:|.   ::||:
 Frog   326 YLSTEGQQTWEQVKEEPVVEQWYNETGFVEDVL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 47/93 (51%)
foxj1.2NP_001008143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..74
COG5025 <61..>262 CDD:227358 61/167 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..99
Forkhead 108..194 CDD:365978 46/90 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..248 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.