DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fd102C

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster


Alignment Length:348 Identity:101/348 - (29%)
Similarity:151/348 - (43%) Gaps:59/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GGAGMEGLMCG--SFSPAFYYQGIDSFLALHNNIWGLPISFLHNSHR---PE--KPPFSYIALIA 101
            ||.|..|....  ..|| :.:.|..|..:::.......||....:.|   ||  ||..|||.|||
  Fly    76 GGTGGSGASAPWLHLSP-YGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIA 139

  Fly   102 MAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAG 166
            |||.|:.:.:|.||.||::|:|.:||:|....||:|||||||||||||:|..|..|        |
  Fly   140 MAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--------G 196

  Fly   167 KGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDF 231
            ||.||.:..:..:.|.:|::|||:.:|        :..:..|...:|.::.     |||.|..| 
  Fly   197 KGHYWAIHPANMEDFRKGDFRRRKAQR--------KVRKHMGLSVDDASTD-----SPSPPPLD- 247

  Fly   232 DIFCNERPNYSDRITDL-------HRQYLSVSLGFNSLFN-NEARGLR----PLPEI---RECPD 281
              .....|..|.....|       |:.|:      ...|| :.|.|:.    |.|.:   |:..:
  Fly   248 --LTTPPPPSSQSALQLSALGYPYHQHYI------GQFFNRSSAPGMTHYSPPDPALLMQRQEAN 304

  Fly   282 DVDASSSSSKAMQSSMELHEELHSPSAFTPPL-----NRRETSSSGAPVLAEAFNGIKDVVDAPG 341
            ::|.:...::..|.........:..|..|..:     ..|:.....|.:||.... |.|:|....
  Fly   305 NLDQTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQ-IVDIVSEDQ 368

  Fly   342 SSPVASSNRSKTTLFTIDNIIGK 364
            .|.|..:..::||..|...:|.|
  Fly   369 ESSVTPTTSARTTTQTHHTVITK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 46/93 (49%)
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 46/91 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.