DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fd96Cb

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:110 Identity:63/110 - (57%)
Similarity:78/110 - (70%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLND 147
            |..|:..:|||:|||:|.||||..:|.:.|.||.||:||||:||:||:|.|.||||:|||||.||
  Fly     5 LKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFND 69

  Fly   148 CFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTR 192
            ||:|:||:..      .|||||||.|...|.||||.|:..|||.|
  Fly    70 CFIKVPRNVT------KAGKGSYWTLHPMAFDMFENGSLLRRRKR 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 56/93 (60%)
fd96CbNP_524496.1 FH 13..101 CDD:214627 56/93 (60%)
Alpha_kinase 106..>194 CDD:295997 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445472
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.