DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxc2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_998857.1 Gene:foxc2 / 407875 XenbaseID:XB-GENE-481382 Length:463 Species:Xenopus tropicalis


Alignment Length:331 Identity:109/331 - (32%)
Similarity:158/331 - (47%) Gaps:89/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PSAVG------------GAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWGLPISF-LHNSHRPE- 90
            |:|:|            .||..|.|.   :|...|...:.:..      |:..|: .::.|:|. 
 Frog    10 PNALGVVPYLSEQNYYRAAGTYGSMA---TPMSVYPAHEQYTP------GMARSYGPYHHHQPAA 65

  Fly    91 -----KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFV 150
                 |||:||||||.|||.:||::::||:|||:||||:||:|||||||||||||||||||:|||
 Frog    66 PKDLVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFV 130

  Fly   151 KIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTR-------RQRHCGHPNRYERESG 208
            |:||      |:...||||||.||..:.:|||.|::.|||.|       |::.    :|..::.|
 Frog   131 KVPR------DDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSREKE----DRILKDQG 185

  Fly   209 KDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRIT--------DLHRQYLSVSLGFNSLFNN 265
            |           ::.|...|        |.|.:..:|.        .:..:..::|....|...:
 Frog   186 K-----------VQGPIPSL--------ELPKHDKKIVIKSESPELPVITKVENLSPDGGSAMQD 231

  Fly   266 EARGLRPLPEI---RECPDDVDASSSSSKAMQSSMELHEELH---SPSAFTP---------PLNR 315
            ..|.:...|.:   ...||...||:..|  :::.|.|....|   ||....|         |:|.
 Frog   232 SPRSVASTPSVSTENSIPDQHPASNGFS--VENIMTLRTSPHGDLSPVPAVPCRTGMVPSLPINY 294

  Fly   316 RETSSS 321
            .:|.||
 Frog   295 TQTQSS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 62/93 (67%)
foxc2NP_998857.1 Forkhead 71..156 CDD:306709 60/90 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.