DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxg1b

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:277 Identity:96/277 - (34%)
Similarity:120/277 - (43%) Gaps:80/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            :||||||.|||.|||..:|.:||||:|||:|||..||||||:|||||||||||||||.||||:||
Zfish    76 DKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCFVKVPR 140

  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCG--------------------- 198
                  ..|..|||:|||||.|:.|:|..|...:.|.|.....|                     
Zfish   141 ------HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSATSRGKLVMKRGLRFAPLGLGLGERP 199

  Fly   199 --------------HPNRYERESGKDSNDGNSSAAEIRSPS-EPLSDFDIFCNERPNYSDRITDL 248
                          |.:.|...:....|.|::....:  |. |||.:               .|:
Zfish   200 SNPLYWQLSPFLPLHHSHYNGSAHGFLNQGHTYGTLL--PGVEPLGN---------------GDM 247

  Fly   249 HRQYLSVSLGFNSLFNN-----EARGL-----------RPLPEIRECPDDVDASSSSSKAMQSSM 297
            .||.|..|.|..:|.|.     .|.||           ...|:..........|||.|..:..|:
Zfish   248 SRQILGASSGSINLSNGYGVSPPAAGLLSGHNGYFVPGAQQPQSLPSAPGYGISSSQSPLLSDSL 312

  Fly   298 ELHEELHSPSAFTPPLN 314
            ..     |..:||.||:
Zfish   313 RT-----SLPSFTSPLS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 62/93 (67%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 62/93 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.