DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxq1b

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_998072.1 Gene:foxq1b / 405843 ZFINID:ZDB-GENE-040426-2090 Length:283 Species:Danio rerio


Alignment Length:295 Identity:95/295 - (32%)
Similarity:135/295 - (45%) Gaps:71/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFV 150
            :.|| |||:||||||||||..:...||||:.|.:::|.|||::|.:..||:||:||||||||||:
Zfish    41 TRRP-KPPYSYIALIAMAIRDSNTGRLTLAEINEYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFL 104

  Fly   151 KIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTR-RQRHCGHPNRYERESGKDSNDG 214
            |:.||.:.     ..||.:||||:..:...|..|.:||||.| .::..|.....||....||   
Zfish   105 KVLRDPSR-----PWGKDNYWMLNPHSEYTFADGVFRRRRKRISKKILGSAESPERVPADDS--- 161

  Fly   215 NSSAAEIRSPS--EPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIR 277
                   |.|:  |.:|.|                      |.|...:|:.:.        |.:|
Zfish   162 -------RLPARDESVSKF----------------------SSSFAIDSILSK--------PFMR 189

  Fly   278 ECPDDVDASSSSSKAMQSSMELHEELHSPSAF-TPPLNRRETSSSGAPVL-------AEAFNGIK 334
            ......|....:::.|.|:.. |   ..|.|. .||.:|.:.||..:.|.       |:..| |.
Zfish   190 REQSTDDTCFGTTRLMMSAAP-H---FLPVAMGFPPQSRFQVSSEVSNVFPIYRCNTADISN-IS 249

  Fly   335 DVVDAPGSSPVASSNRSKTTL-------FTIDNII 362
            .:.|...|.|..:  .|.|||       |.||:::
Zfish   250 RMADIQSSLPGLA--HSHTTLQEAGFHPFRIDSLL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 47/93 (51%)
foxq1bNP_998072.1 FH 45..134 CDD:214627 47/93 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.