DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXI2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_997309.2 Gene:FOXI2 / 399823 HGNCID:32448 Length:318 Species:Homo sapiens


Alignment Length:276 Identity:95/276 - (34%)
Similarity:129/276 - (46%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ANPDYLRTQVSPNPLAP---SAVGGAGMEGLMCGSFSPAFY--------------YQGIDSFLAL 71
            |.|...:....|....|   .||||..:..:...:.||..|              |......|..
Human    13 APPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPAPPYAAPSYGAPGPLLGA 77

  Fly    72 HNNIWGLPISFLHNSHRPE-----KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYREN 131
            ...:.|..:::|..|.:.|     :||:||.|||||||.|||.::||||.||:::...||:|:.:
Human    78 PGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRKLTLSQIYQYVAGNFPFYKRS 142

  Fly   132 KQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRH 196
            |.||||||||||||||||.|:|||:      |..|||:||.||.:...||:.||:||:|.||   
Human   143 KAGWQNSIRHNLSLNDCFKKVPRDE------DDPGKGNYWTLDPNCEKMFDNGNFRRKRKRR--- 198

  Fly   197 CGHPNRYERESGKDSNDGNSSAAEIRSPS-EPLSD--FDIFCNERPNYSDRITDLHRQYLSVSLG 258
                    .|:......|..|.....:|: ||.|.  .|:..:..|:..:..|...        |
Human   199 --------AEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPEAATCFS--------G 247

  Fly   259 FNSLFNNEARGLRPLP 274
            |.|..:..|.||...|
Human   248 FASAMSALAGGLGTFP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 54/93 (58%)
FOXI2NP_997309.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 3/16 (19%)
Forkhead 102..188 CDD:278670 54/91 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.