DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxa4

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_988938.1 Gene:foxa4 / 394535 XenbaseID:XB-GENE-486455 Length:399 Species:Xenopus tropicalis


Alignment Length:247 Identity:93/247 - (37%)
Similarity:125/247 - (50%) Gaps:50/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VNSMLANPDYLRTQVSPNPLA------------PSAVGGAGMEGL----MCGSF-----SPAF-- 60
            :|:.|.:..:|.|.||..|.:            .|..|..|..|.    |.||.     :||:  
 Frog    31 MNNGLPSNSFLPTDVSTVPTSMPYMSNGLSGPVTSIQGNLGSLGSMTQGMVGSLAPPASTPAYPM 95

  Fly    61 -YYQGIDSFLALHNNIWGLPISFLHN-SHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMD 123
             |.||...|..       .|.::..| ||  .|||:|||:||.|||..|||:.:||:.||::|:|
 Frog    96 GYCQGESEFQR-------DPRTYRRNYSH--AKPPYSYISLITMAIQQAPNKMMTLNEIYQWIID 151

  Fly   124 KFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRR 188
            .|||||:|:|.|||||||:||.||||||:||..      :..||||||.|...:.:|||.|.|.|
 Frog   152 LFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSP------EKPGKGSYWTLHPESGNMFENGCYLR 210

  Fly   189 RRTR----------RQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSD 230
            |:.|          |::....|......|.|::..|....:..|||..|::|
 Frog   211 RQKRFKCERSKSGEREKKVNKPGDENGGSLKETPVGYDDCSSSRSPQAPVND 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 54/93 (58%)
foxa4NP_988938.1 Forkhead_N <25..118 CDD:369872 24/95 (25%)
COG5025 <118..303 CDD:227358 69/151 (46%)
FH 119..207 CDD:214627 54/93 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..290 10/44 (23%)
HNF_C 326..387 CDD:370449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.