DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxm1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_957391.1 Gene:foxm1 / 394072 ZFINID:ZDB-GENE-040426-1275 Length:623 Species:Danio rerio


Alignment Length:362 Identity:92/362 - (25%)
Similarity:140/362 - (38%) Gaps:123/362 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE-NKQGWQNSIRHNLSLNDC 148
            |....|:||:||:|:|..||:|..|:.:||..||.:|.|.|||:|: .|.||:|||||||||:|.
Zfish   176 NDPHSERPPYSYMAMIQFAINSKNNRHMTLKEIYNWIEDHFPYFRDIAKPGWKNSIRHNLSLHDM 240

  Fly   149 FVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQ--RHCGHP----------- 200
            |::         :....||.|||.:...|:         |..|..|  :..|.|           
Zfish   241 FIR---------ETSPDGKISYWTIRPEAN---------RCLTLDQVYKPLGDPLTPTCPQIPQV 287

  Fly   201 --NRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLF 263
              ::.::....:......:........:||         .|.     ||.:...:.:.|| .|||
Zfish   288 AIHQQQKRGAPELKKAIPALGGTERKMKPL---------LPR-----TDSYLVPIQLPLG-QSLF 337

  Fly   264 NNEARGLRPLP-----EIRECPDDVDASSSSS--------KAMQS-----------SMELHEE-L 303
                     ||     .:...|...::|:.||        |..||           |.|:.|| :
Zfish   338 ---------LPTSSPVSLSTPPQTQNSSTPSSSKRVRIAPKVSQSDLSSVLLCKPASQEIKEEPV 393

  Fly   304 HSP---SAFTPPLNRRETSSSG------------APVL----AEAFNG--IKDV----------- 336
            ..|   |...||.:||..:||.            .|||    :..|:.  |.|:           
Zfish   394 FQPVTSSEAPPPKSRRTDNSSSRRKQRLVLPATEEPVLLYPDSTLFDSGVISDISTFQDTREADP 458

  Fly   337 ---VDAPG-----SSPVASSNRSKTTLFTIDNIIGKP 365
               :|:|.     .:|:.||:.|.:|...:..:..:|
Zfish   459 KPELDSPNREYSFKTPIKSSHPSSSTPSKLPTVTLEP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 40/94 (43%)
foxm1NP_957391.1 FH 182..256 CDD:238016 39/82 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.