DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FoxK

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:245 Identity:80/245 - (32%)
Similarity:113/245 - (46%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYR-ENKQGWQNSIRHNLS 144
            |:.||    ||||:||..||..|||:||:::|||||||.||:..:|||| |..:|||||||||||
  Fly   447 SYNHN----EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507

  Fly   145 LNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGK 209
            ||..|:|:.|.:      |..||||:|.:|..:.......:|::||.|..:....|....|.   
  Fly   508 LNRYFIKVARSQ------DEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRS--- 563

  Fly   210 DSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLP 274
                         :|..| |..|   |.|.  |..:.|:..|....|.|.:.             
  Fly   564 -------------APVSP-SHMD---NSRE--SSPLQDIVLQSAPGSPGMSL------------- 596

  Fly   275 EIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAP 324
            |.|....::..:|.::...|...:..::..:.|      |.....|||:|
  Fly   597 EQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLS------NNSNQYSSGSP 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 49/94 (52%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/92 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445474
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.