DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and bin

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster


Alignment Length:375 Identity:105/375 - (28%)
Similarity:153/375 - (40%) Gaps:81/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RTQVSPNPLAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLA----LHNNIWGLPI---------- 80
            |...||:.:..:| .|..:......|.|||....|.:|...    |.|.:.|..:          
  Fly   230 RISTSPSQVISNA-HGMPVLNYSSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQD 293

  Fly    81 -------SFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNS 138
                   :....:.|||||..|||.:|..||..:|..:||||.||.::...:.::|....||:||
  Fly   294 APSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNS 358

  Fly   139 IRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQR-------H 196
            :|||||||:||.|:|:....    ...|||:||.:|.:::.:||.....|||.|..|       :
  Fly   359 VRHNLSLNECFKKLPKGMGV----GKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPY 419

  Fly   197 CGHPNRYERESGKDS--NDGNSSAAEIRSPSEPLSDFDI--FCNERPNYSDRITD------LHRQ 251
            .||.|.|......|:  ::||..|    ||:....|:..  .....|.......|      .|..
  Fly   420 AGHANGYYASGYGDAGMDNGNYYA----SPAFASYDYSAAGATGVSPAGGQGFADPWNAHAAHSG 480

  Fly   252 YLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRR 316
            ..||.:|.         |:.|||:.         ::.|..|...::       :.||.||||...
  Fly   481 SSSVGVGM---------GVGPLPQY---------TNISCLAAGGNV-------NGSATTPPLAHS 520

  Fly   317 ------ETSSSGAPVLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTIDN 360
                  ..|||.:| |..|.....|.  ||.:|.||:.....|:..::||
  Fly   521 ALGMAPSASSSSSP-LGAAATLQSDY--APTASLVAAGYSYATSAGSLDN 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 39/93 (42%)
binNP_523950.2 Forkhead 311..399 CDD:278670 38/91 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.