DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxl3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:247 Identity:91/247 - (36%)
Similarity:113/247 - (45%) Gaps:80/247 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            |..:|.:||||||||||..:|..|:||||||.|||.||||||.|::.||||||||||||.||||:
Mouse    29 RLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKV 93

  Fly   153 PRDKNTIEDNDSAGKGSYWMLD---SSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDG 214
            ||    .|.||. |||:||...   .|..|:||.||:||||.||     .|.|            
Mouse    94 PR----TEGNDK-GKGNYWTFAGGCESLLDLFENGNFRRRRRRR-----GPKR------------ 136

  Fly   215 NSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIREC 279
                .|...|.||                                      .||| .|.|:..:.
Mouse   137 ----EEAPGPLEP--------------------------------------TARG-SPGPDSAQA 158

  Fly   280 PD-DVDASSSSSKAMQSSME-----------LHEELHSPSAFTPPLNRRETS 319
            || :..||.::.:.::.|::           |....||..|..|.|..::.|
Mouse   159 PDHEAQASPTTHRDIKFSIDYILSSPDPFPTLRSSCHSQEARYPALEPQQMS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 59/96 (61%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 56/90 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.