DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxc1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_599165.1 Gene:Foxc1 / 364706 RGDID:1589718 Length:553 Species:Rattus norvegicus


Alignment Length:380 Identity:124/380 - (32%)
Similarity:173/380 - (45%) Gaps:103/380 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSMLANPDYLRTQVSPNPLAPSAVGG--AGMEGLMCGSFSPAF--YYQGIDSFLALHNNIWGLPI 80
            ||:...| ||..:.|....|.:|.||  ..|...|.....||.  .|.|            |:..
  Rat    11 NSLGVVP-YLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPG------------GMAR 62

  Fly    81 SFLHNSHRPE-----KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIR 140
            ::...:.:|:     |||:||||||.|||.:||::::||:|||:||||:||:||:||||||||||
  Rat    63 AYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIR 127

  Fly   141 HNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYER 205
            ||||||:||||:||      |:...||||||.||..:.:|||.|::.|||.|.::.....::.|:
  Rat   128 HNLSLNECFVKVPR------DDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEK 186

  Fly   206 -----------ESGKDSNDGNSSAAEIRSP---SEPLSDFDI-----FCNERPNYSDRITDLHRQ 251
                       ::|:.........||..:|   ..|:...||     .|...|           |
  Rat   187 GRLHLQEPPPPQAGRQPAPAPPEQAEGSAPGPQQPPVRIQDIKTENGTCPSPP-----------Q 240

  Fly   252 YLS--VSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLN 314
            .||  .:||..|        ...:|:| |.||...:|.||..:...|:        |||....|:
  Rat   241 PLSPAAALGSGS--------AATVPKI-ESPDSSSSSLSSGSSPPGSL--------PSARPLSLD 288

  Fly   315 RRETSSSGAPVLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTIDNII----GKP 365
            ..|                    .||...|....:.|:.  |::|||:    |.|
  Rat   289 AAE--------------------PAPPPQPAPPPHHSQG--FSVDNIMTSLRGSP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 61/93 (66%)
Foxc1NP_599165.1 FH 78..166 CDD:214627 61/93 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.