DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fd19B

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:148 Identity:64/148 - (43%)
Similarity:80/148 - (54%) Gaps:16/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            ||.|:|.|||.|||.|:..:|||||||.|:|.|.|||||..|..||||||||||||..||::||.
  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDM--------FEQGNYRRRRTRRQRHCGHPNRYERESGKDSN 212
            .      |..|:|.||.||..|.|:        ..:.|:::....|.:..|||  |:|.......
  Fly   123 L------DDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHP--YQRMPYYGHG 179

  Fly   213 DGNSSAAEIRSPSEPLSD 230
            .||....:..|...|:.|
  Fly   180 HGNGPYIKAHSAYFPIMD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 52/101 (51%)
fd19BNP_608369.1 FH 58..135 CDD:238016 48/82 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445469
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.