DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXA3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_004488.2 Gene:FOXA3 / 3171 HGNCID:5023 Length:350 Species:Homo sapiens


Alignment Length:375 Identity:114/375 - (30%)
Similarity:156/375 - (41%) Gaps:90/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ANGSMLPDNEELVNSMLANPDY--LRTQVSPNPL-APSAVGGAGMEGLMCGSFSPAF-------Y 61
            |..|..|:..|:.:.:...|..  |.:.::.||| :|...||.....|..|..:|..       .
Human    13 AEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPT 77

  Fly    62 YQGIDSFLALHNNIWGLP-ISFLHNSHRPE---------KPPFSYIALIAMAISSAPNQRLTLSG 116
            :.|:.......::.:|.| ...:|....|:         |||:|||:||.|||..||.:.||||.
Human    78 FPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSE 142

  Fly   117 IYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMF 181
            ||::|||.|||||||:|.|||||||:||.||||||:.|..      |..||||||.|..|:.:||
Human   143 IYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSP------DKPGKGSYWALHPSSGNMF 201

  Fly   182 EQGNYRRRRTR-------RQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERP 239
            |.|.|.||:.|       ::...|........:|..::. .:.||.:.||.:|..          
Human   202 ENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST-TTPAATVTSPPQPPP---------- 255

  Fly   240 NYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIR-ECPDDVDA----SSSSSKAMQSSMEL 299
                                            |.||.. :..:||.|    |.:||....:.:||
Human   256 --------------------------------PAPEPEAQGGEDVGALDCGSPASSTPYFTGLEL 288

  Fly   300 HEE--LHSPSAFTPPL---NRRETSSSGAPVLAEAFNGIKDVVDAPGSSP 344
            ..|  |.:|..|..|.   |.....:...|.|...|.|    ..|.|..|
Human   289 PGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGG----YGAEGGEP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 58/93 (62%)
FOXA3NP_004488.2 FH 117..205 CDD:214627 58/93 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..276 13/101 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.