DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxj3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:337 Identity:94/337 - (27%)
Similarity:143/337 - (42%) Gaps:100/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVK 151
            |:..|||:||.:||..||:|:|.:::|||.||::|.|.||||||...||:||||||||||.||:|
  Rat    74 HKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLK 138

  Fly   152 IPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERES--------- 207
            :||.|      |..||||||.:|::..: .......::|.|.......|...:.:|         
  Rat   139 VPRSK------DDPGKGSYWAIDTNPKE-DTLPTRPKKRARSVERASTPYSIDSDSLGMECIISG 196

  Fly   208 -----------------------GKDS--NDGNSSAAE-------------------IRSPSEPL 228
                                   |.||  :..|:|.::                   :.:..||:
  Rat   197 SASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTNHPEPV 261

  Fly   229 SDFDIFCNERPNYSDRITDLHRQYL-------SVSLGFNSLFNN------EARGLRPLPEIRECP 280
            |. .:...::|.|:  :.:..:|.|       .:|..|.||:.:      ..:||..:|      
  Rat   262 SQ-SLTPQQQPQYN--LPERDKQLLFTEYNFEDLSASFRSLYKSVFEQSLSQQGLMSIP------ 317

  Fly   281 DDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGIKDVVDAPGSSPV 345
                  |.||:...:|....   ||||: |...:.....||    |....:|:    .|.||:.|
  Rat   318 ------SESSQQSHTSCSYQ---HSPSS-TVTSHPHSNQSS----LPNNHSGL----SATGSNSV 364

  Fly   346 ASSNRSKTTLFT 357
            |..:.|...:.|
  Rat   365 AQVSLSHPQMHT 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 50/93 (54%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 83/296 (28%)
FH_FOXJ3 77..155 CDD:410826 49/83 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.