DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxd2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_233422.5 Gene:Foxd2 / 313504 RGDID:1304642 Length:494 Species:Rattus norvegicus


Alignment Length:324 Identity:103/324 - (31%)
Similarity:141/324 - (43%) Gaps:87/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||||||.|||..:|.:|||||.|.:||..:||||||....||||||||||||||||||||:
  Rat   131 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 195

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQR----------HCGHPNRYERESGKD 210
            ..      :.|||:||.||..::|||:.|::.|||.|.:|          | .||....|     
  Rat   196 PG------NPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPPHPHPH-PHPELLLR----- 248

  Fly   211 SNDGNSSAAEIRSPSEPLSDFDIF----------------------CNERPN-YSDRITDLHRQY 252
               |.::||  ..|...||.|..:                      .:..|: ::..........
  Rat   249 ---GGAAAA--GDPGAFLSGFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAATAPCQ 308

  Fly   253 LSVSLG----------FNSLFNNEARGLRPLPEIRECPDD------VDASSSSSKAMQSSMELHE 301
            |||..|          ..|:|.:......|.|.....|..      :.|....:||..       
  Rat   309 LSVPPGRAAAPPPGPPTASVFASATSAPAPAPAPGSGPSPAGLPAFLGAELGCAKAFY------- 366

  Fly   302 ELHSPSAFTPPLNRRETSSSGAPVLAEAF--NGIKDVVDAPGSSPVASSNRSKTTLFTIDNIIG 363
                |::.:||      ::..|..|:.|.  .|:|  .||.|.:....:...:...|:||:|:|
  Rat   367 ----PASLSPP------AAGTAATLSSALLRQGLK--TDAGGGAGGGGAGAGQRPSFSIDHIMG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)
Foxd2XP_233422.5 FH_FOXD1_D2-like 131..229 CDD:410820 62/103 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.