DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxs1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:310 Identity:102/310 - (32%)
Similarity:141/310 - (45%) Gaps:74/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFV 150
            |..|.|||:||||||||||.|:|.||.||||||::||.:|.:||.|:.|||||||||||||:|||
  Rat    13 STEPSKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFV 77

  Fly   151 KIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCG---------HPNRYERE 206
            |:||      |:...||||||.||....|||:.|::.|||.|..:..|         ..:|..|.
  Rat    78 KVPR------DDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVKADHRPLRA 136

  Fly   207 SGKDSNDGNSSAAEI------------------------------RSPSEPLSDFDIFCNERPNY 241
            :..|....|::...:                              ..|..|....|: |:.:...
  Rat   137 TSPDQGAPNTTTGRLCPFPPEVPNPKGFGGLMGSLPANMCPTTSDTRPQLPTGPKDM-CSAKSGG 200

  Fly   242 SDRITDLHRQYLSVSLGFNSLFNN-EARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHS 305
            ...:::........:.||:|.|:. |:.|..|.|.:  .|:.:  .||....||:       |:.
  Rat   201 PRELSEATSPSPCPAFGFSSAFSEAESLGKAPTPSV--APESI--GSSYQCRMQT-------LNF 254

  Fly   306 PSAFTPPLNRRETSSSGAPVLAEAFNGIKDVVDAPGSSPVASSNRSKTTL 355
            .....|.|....||:                |..||||..::|:|:...|
  Rat   255 CMGADPGLEHLLTSA----------------VATPGSSTPSASHRAPLPL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 60/93 (65%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 59/90 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.