DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxa

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_571357.2 Gene:foxa / 30539 ZFINID:ZDB-GENE-990415-76 Length:355 Species:Danio rerio


Alignment Length:377 Identity:121/377 - (32%)
Similarity:156/377 - (41%) Gaps:114/377 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLAPSAVGGAGMEGLMCGSFSPAFYYQ--GI--DSFLALHNNIWGLPISFLH-----------NS 86
            ||.|.            |...|..:||  |:  ||..|::....|.|...|.           ||
Zfish    29 PLGPR------------GYSPPEHHYQSYGVQCDSAPAVNPGRLGSPAGLLPPANPPKAYAEINS 81

  Fly    87 HRPE---------------KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQ 136
            ..||               |||:|||:||.|||..:|.:||||:.||.:|...|||||:|:|.||
Zfish    82 SEPEFQELKSVYRRTLSHAKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQ 146

  Fly   137 NSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPN 201
            |||||:||.|||||::||..      ||.||||||.|...:.:|||.|.|.||:.|.:  |....
Zfish   147 NSIRHSLSFNDCFVRVPRSP------DSPGKGSYWALHPDSGNMFENGCYMRRQKRFK--CQKST 203

  Fly   202 RYERES-GKDSNDGNSSAAEIRSPS---EPLSDFD-------IFCNERPNYSDRITDLHRQYLSV 255
            ...:.| |:|.........||:|.|   .|.||..       .:.|.:|.....:...|      
Zfish   204 STGKNSEGEDVKVEKKKKKEIKSVSSCKSPTSDATKQSSTTVSYANTKPASPSHLNPSH------ 262

  Fly   256 SLGFNSLFNNEARGLRPLPEI-RECPDDVDASSSSSKAMQSSME--LHEE---LHSPSAF----- 309
                 :||..:.      ||| ...|       |.|....:|||  ||.|   .|.|.:.     
Zfish   263 -----TLFPTQP------PEISTHLP-------SLSVPFPASMETSLHCEPSSQHQPISVPRLVD 309

  Fly   310 -----TP---PLNRRETSSSGAPVLAEAFNGIKDVVDAPG----SSPVASSN 349
                 ||   ||..:..|.:..|      :...|.|..||    |:|:.||:
Zfish   310 FQYCETPVSYPLYCQSNSHANFP------SYTTDSVYYPGFSMCSTPLLSSS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 54/93 (58%)
foxaNP_571357.2 FH 101..189 CDD:214627 54/93 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2284
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.