DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxd5

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:285 Identity:99/285 - (34%)
Similarity:137/285 - (48%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||||||.|||..:|.::||||||..||.:|||||:|....|||||||||||||||:||||:
Zfish    73 KPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPRE 137

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAE 220
            ..      :.|||:||.||.::.|||:.|::.|||.|.:|:       :.|..|||.........
Zfish   138 PG------NPGKGNYWSLDPASEDMFDNGSFLRRRKRFKRN-------QPEFTKDSLVLYHPTLS 189

  Fly   221 IRSPSEPLSDFDIFC--NERPNYSDRITDLHRQYLSVSLGF---NSLFNNEARGLR--PLPEIRE 278
            .|:...|      :|  ...|..::.:     .||.|..|.   ...|..:...::  ..|||::
Zfish   190 YRAYGRP------YCVSGAVPAQTNPV-----GYLPVPDGIMVPPPFFQYQTMNIKIHDAPEIQQ 243

  Fly   279 CP-----------DDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNG 332
            .|           |.:.|.|:.|.:..|:..|..:.    :|..|   |.|:|..||.|      
Zfish   244 RPEHKTQRCSFSIDSIMAKSTESSSKSSAHHLTPDY----SFVFP---RPTTSCVAPSL------ 295

  Fly   333 IKDVVDAPGSSPVASSNRSKTTLFT 357
                |..|..:|:.     ||..|:
Zfish   296 ----VPVPTRTPLL-----KTVPFS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 56/93 (60%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 56/91 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.