DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxk1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001032296.2 Gene:Foxk1 / 304298 RGDID:1309643 Length:719 Species:Rattus norvegicus


Alignment Length:366 Identity:105/366 - (28%)
Similarity:144/366 - (39%) Gaps:123/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LANPDYLRTQVSPNP----------LAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWG 77
            :..|| ||:.|||.|          ..|::..|||.        |...:.|.:.|.|.|......
  Rat   215 IPEPD-LRSLVSPIPSPTGTISVPNSCPASPRGAGS--------SSYRFVQNVTSDLQLAAEFAA 270

  Fly    78 LPISFLH------NSHRPE-KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGW 135
            ...|...      :|.:.| |||:||..||..|||||.:::|||||||..|...:||||...:||
  Rat   271 KAASEQQADTSGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGW 335

  Fly   136 QNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLD-SSASDMFEQGNYRRRRTRRQRHCGH 199
            |||||||||||..|:|:||.:      :..||||:|.:| :|.:.:.||. :|:||.|       
  Rat   336 QNSIRHNLSLNRYFIKVPRSQ------EEPGKGSFWRIDPASEAKLVEQA-FRKRRQR------- 386

  Fly   200 PNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFN 264
                             ..:..|:|..|||          :.|...:..|          ..|.:
  Rat   387 -----------------GVSCFRTPFGPLS----------SRSAPASPTH----------PGLMS 414

  Fly   265 NEARGLRPLPEI--RE---CPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAP 324
            ..:.||: .||.  ||   .|.|.|..|..:..                   |..|...|:.|:|
  Rat   415 PRSSGLQ-TPECLSREGSPIPHDPDLGSKLASV-------------------PEYRYSQSAPGSP 459

  Fly   325 VLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTIDNIIGKP 365
            |.|:      .|:.|....|              .|::.||
  Rat   460 VSAQ------PVIMAVPPRP--------------SNLVAKP 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 50/94 (53%)
Foxk1NP_001032296.2 FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 48/91 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.