DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxk2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_006247952.1 Gene:Foxk2 / 303753 RGDID:1305408 Length:650 Species:Rattus norvegicus


Alignment Length:359 Identity:98/359 - (27%)
Similarity:137/359 - (38%) Gaps:132/359 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PDYLRTQVSPNP----------LAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWGLPI 80
            ||.:...:||.|          ..||:..|||..|...|...|:                   .:
  Rat   178 PDTMAHLISPLPSPTGTISAANSCPSSPRGAGSSGYKMGRVIPS-------------------DL 223

  Fly    81 SFLHNSHRPE---------------KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE 130
            :.:.::.:||               |||:||..||..||:.||:::|||:|||..|...:||||.
  Rat   224 NLMADNSQPENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRT 288

  Fly   131 NKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLD-SSASDMFEQGNYRRRRTRRQ 194
            ..:|||||||||||||..|:|:||.:      :..||||:|.:| :|.|.:.||. :|:||.|  
  Rat   289 ADKGWQNSIRHNLSLNRYFIKVPRSQ------EEPGKGSFWRIDPASESKLVEQA-FRKRRPR-- 344

  Fly   195 RHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGF 259
               |.|.                   .|:|..|||.                             
  Rat   345 ---GVPC-------------------FRTPLGPLSS----------------------------- 358

  Fly   260 NSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAP 324
                       |..|   ..|:.....|:.|...|:...|..| .||:...|   ....|.....
  Rat   359 -----------RSAP---ASPNHAGVLSAHSSGAQTPESLSRE-GSPAPLEP---EPGASQPKLA 405

  Fly   325 VLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTI 358
            |:.||    :....||| ||::    |:..|.|:
  Rat   406 VIQEA----RFAQSAPG-SPLS----SQPVLITV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 49/94 (52%)
Foxk2XP_006247952.1 FHA 41..145 CDD:238017
Forkhead 249..335 CDD:278670 47/91 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.