DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxg1a

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_571142.1 Gene:foxg1a / 30274 ZFINID:ZDB-GENE-990415-267 Length:420 Species:Danio rerio


Alignment Length:213 Identity:90/213 - (42%)
Similarity:103/213 - (48%) Gaps:72/213 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            |||||||.|||.|||..:|.:||||:|||:|||..||||||||||||||||||||||.||||:||
Zfish   112 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPR 176

  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMF---EQGNYRRRRTRRQRHCG------------------ 198
                  ..|..|||:|||||.|:.|:|   ..|..|||.|..:....                  
Zfish   177 ------HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRA 235

  Fly   199 --------------HPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLH 249
                          ||    |.|...|.:|.|||    .||.|:|           ||..:|.  
Zfish   236 GSLYWPMSPFLSLHHP----RASSALSYNGASSA----YPSHPMS-----------YSTMLTQ-- 279

  Fly   250 RQYLSVSLGFNSLFNNEA 267
                      |||.||.:
Zfish   280 ----------NSLGNNHS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 63/96 (66%)
foxg1aNP_571142.1 FH 113..201 CDD:214627 63/93 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.