DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxh1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_008763787.1 Gene:Foxh1 / 300054 RGDID:1311275 Length:416 Species:Rattus norvegicus


Alignment Length:264 Identity:66/264 - (25%)
Similarity:111/264 - (42%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            |.:|||::|:|:||:              |.:.:...||::|::.:||::|||||||.|.||.|:
  Rat    90 RHDKPPYTYLAMIAL--------------IIRQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFRKV 140

  Fly   153 PRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRT---RRQRHCGHPNRYERESGKDSNDG 214
            |:|....:     .||::|.:|.|   :......|.:.|   ||.::.|    ..|...||.:..
  Rat   141 PKDPAKPQ-----AKGNFWAVDVS---LIPAEALRLQNTALCRRWQNRG----THRAFAKDLSPY 193

  Fly   215 NSSAAEIRSPSEP---LSDFDI-----------FCNERPNYSDRITDLHRQYLS-----VSLGFN 260
            .......|.||.|   ..||.|           ...:.|..:.:.|......||     :..|.:
  Rat   194 VLHGQPYRPPSPPPPSREDFSIKSLLGDPGKASTWPQHPRLAGQSTPAQASTLSKGEEGIGAGPS 258

  Fly   261 SLFNNEARGLRPLPEIRECPDDVDASSSSSKAM--------QSSMELHEELHSPSAFTPPLNRRE 317
            ::.:.....|..||.    |..::..:|..:.:        |.|..||  |...|:.:..::||.
  Rat   259 NVSDKPLWPLSSLPR----PTRIEGETSQGEVIRPSPVSSDQGSWPLH--LLQDSSDSMGMSRRG 317

  Fly   318 TSSS 321
            :.:|
  Rat   318 SRAS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 31/93 (33%)
Foxh1XP_008763787.1 FH 93..157 CDD:294049 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.