DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxi1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:356 Identity:110/356 - (30%)
Similarity:156/356 - (43%) Gaps:95/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DYLRTQVSPNPLAPSAVGGAGMEG--------LMCGSFSPAFYYQGIDS--FL---------ALH 72
            ::...|..|:|..|::..|.|..|        |...:.:|..|..|.::  ||         .|.
  Rat    34 NFFHPQGMPSPQRPTSFEGGGEYGATPNPYLWLNGTAMTPPPYLPGTNASPFLPQAYGMQRQLLP 98

  Fly    73 NNIWGLPISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQN 137
            :.:..|||.......:..:||:||.|||||||..||:||||||.||:::.|.||:|.::|.||||
  Rat    99 SELGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQN 163

  Fly   138 SIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNR 202
            ||||||||||||.|:|||:      |..|||:||.||.:...||:.||:||:|.|:         
  Rat   164 SIRHNLSLNDCFKKVPRDE------DDPGKGNYWTLDPNCEKMFDNGNFRRKRKRK--------- 213

  Fly   203 YERESGKDSNDGNSSAAEIRS-------------PSEPLSDFDIFC--------NERPNYSDRIT 246
                     :|.:||...:.|             |:||....|...        .:|.:.:...|
  Rat   214 ---------SDASSSTGSLASEKTENRLLSSSPKPTEPQEVLDTASPDTTSSSPEKRSSPAPSGT 269

  Fly   247 DLHRQYLSVSL----GFNSLFNNEAR-GLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSP 306
            .....:||...    |.|.:..:.|. ||.|.|        ||      |..|:|:..       
  Rat   270 PCLNNFLSTMTAYVNGTNPISRSAATPGLSPEP--------VD------KMGQNSLNF------- 313

  Fly   307 SAFTPPLNRRETSSSG-----APVLAEAFNG 332
            :::||..|.....:.|     .|..|..:.|
  Rat   314 NSYTPLTNLSSHGNGGEWANPVPTNALGYGG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 56/93 (60%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 56/93 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4368
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.