DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXD3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_036315.1 Gene:FOXD3 / 27022 HGNCID:3804 Length:478 Species:Homo sapiens


Alignment Length:358 Identity:114/358 - (31%)
Similarity:143/358 - (39%) Gaps:102/358 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLAPSAVGGAGME-------GLMCGSFSPAFYYQGIDSFLALHNNIWGLPISFLHNSHRPEKPPF 94
            |.|....||.|.|       |...||.|..                 ||..|...||  ..|||:
Human    99 PEADGCKGGVGGEEGGASGGGPGAGSGSAG-----------------GLAPSKPKNS--LVKPPY 144

  Fly    95 SYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTI 159
            ||||||.|||..:|.::||||||.:||.::||||||....||||||||||||||||||||:..  
Human   145 SYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPG-- 207

  Fly   160 EDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAEIRSP 224
                :.|||:||.||..:.|||:.|::.|||.|.:||.....| |:.:....:.|..|.|.....
Human   208 ----NPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLR-EQTALMMQSFGAYSLAAAAGA 267

  Fly   225 SEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSS 289
            :.|..                    |.|                ||.|.         ..|.:.|
Human   268 AGPYG--------------------RPY----------------GLHPA---------AAAGAYS 287

  Fly   290 SKAMQSSMELHEELHSPSAFTP---------------PLNRRETS--SSGAPVLAEAFNGIKDVV 337
            ..|..::......|..|.|..|               .|.|:..:  |...|.|....|.:....
Human   288 HPAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPGLQLQLNSLGAAA 352

  Fly   338 DAPGSSPVA-------SSNRSKTTLFTIDNIIG 363
            .|.|::..|       .|..|....|:|:||||
Human   353 AAAGTAGAAGTTASLIKSEPSARPSFSIENIIG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)
FOXD3NP_036315.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136 13/53 (25%)
Forkhead 141..227 CDD:278670 57/91 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.