DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxi2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:365 Identity:111/365 - (30%)
Similarity:154/365 - (42%) Gaps:89/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSCYANGSMLPDNEELVNSMLANPDYLRTQVSPNP---LAPSAVGGAGMEGLMCGSFSPAFYYQG 64
            |..|....:.......|||...:|....|...|.|   .|..||.|                   
Mouse    24 PPSYGRTDLSSGRRLWVNSAALSPAPYATGPGPAPSYAAATLAVPG------------------- 69

  Fly    65 IDSFLALHNNIWGLPISFLHNSHRPE-----KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDK 124
              |.|.....:.|..:::|..|.:.|     :||:||.|||||||.|||.:|||||.||:::...
Mouse    70 --SLLGASGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGN 132

  Fly   125 FPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRR 189
            ||:|:.:|.||||||||||||||||.|:|||:|      ..|||:||.||.:...||:.||:||:
Mouse   133 FPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEN------DPGKGNYWTLDPNCEKMFDNGNFRRK 191

  Fly   190 RTRRQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLS 254
            |.||    |..:. ....|..|.:|.:......:|.:|.:.        |:.|:..|..    ||
Mouse   192 RRRR----GETSE-AAVPGASSPEGTALEPRGSTPQDPQTS--------PSPSEATTTC----LS 239

  Fly   255 VSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETS 319
               ||::.....|.|...||:                         ...|..|...||    .|:
Mouse   240 ---GFSTAMGALAGGFGALPD-------------------------GLAHDFSLRRPP----PTA 272

  Fly   320 SSGAPVLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTID 359
            ::.:|.:.....|.     |||....|:..|....:::.|
Mouse   273 AAHSPQIPNTAPGF-----APGHQTGATGFRMGHLIYSRD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 55/93 (59%)
Foxi2NP_899016.2 Forkhead 99..184 CDD:333958 54/90 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237 14/61 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4419
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.