DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and mei4

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_595617.1 Gene:mei4 / 2540241 PomBaseID:SPBC32H8.11 Length:517 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:79/261 - (30%)
Similarity:112/261 - (42%) Gaps:85/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            ||||.||..||.:||..:.|::|||||||.:|.:.|.||..:..|||||||||||||..|:|:.:
pombe    80 EKPPCSYATLIGLAILQSHNKQLTLSGIYTWIRNTFRYYLNHDGGWQNSIRHNLSLNKAFIKVEK 144

  Fly   155 DK-NTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGK--------- 209
            .| .|:       ||.||.:|..     ...|:...|..|. |....|..:|.|.|         
pombe   145 PKGKTL-------KGHYWTIDPD-----HMQNFVSVRLHRS-HSTDSNSKKRPSSKCHEIKPLTT 196

  Fly   210 ------------------DSNDGNSS--AAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLS 254
                              .|..|:||  |||:.:.:...|:.|                      
pombe   197 REIPLARKRSRLNSFNSSTSTSGSSSNVAAEVSNDASQPSNQD---------------------- 239

  Fly   255 VSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAM-QSSMELHEELHSPSAFTPPLNRRET 318
                 :||.:|..:  .|||     |.:|.::||||:.: :.:.|..|:|       |.::..|:
pombe   240 -----SSLNSNIVK--PPLP-----PSNVQSNSSSSENVPKPNAETQEDL-------PTIDAHES 285

  Fly   319 S 319
            |
pombe   286 S 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 43/94 (46%)
mei4NP_595617.1 COG5025 1..517 CDD:227358 79/261 (30%)
Forkhead 81..167 CDD:278670 44/97 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47190
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 1 1.000 - - X2284
TreeFam 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.