DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fkh2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_596764.1 Gene:fkh2 / 2539703 PomBaseID:SPBC16G5.15c Length:642 Species:Schizosaccharomyces pombe


Alignment Length:279 Identity:73/279 - (26%)
Similarity:108/279 - (38%) Gaps:90/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            :|||:||..:||.||.|:....:|||.||.:|...:||||..|.|||||||||||||..|.|:||
pombe   222 KKPPYSYSVMIAQAILSSSECMMTLSNIYSWISTHYPYYRTTKSGWQNSIRHNLSLNKAFRKVPR 286

  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAA 219
                  .:...|||..|   |...:..|:...:.|:|.|:                         
pombe   287 ------KSGEQGKGMKW---SIVPEFREEFIAKTRKTPRK------------------------- 317

  Fly   220 EIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECPDD-- 282
              ||||.|:   .:...:|.                  |..||         |:|.:.:..|.  
pombe   318 --RSPSSPV---PLLAKKRE------------------GSPSL---------PIPILPKMKDTSI 350

  Fly   283 --VDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGIKDVVD------- 338
              .:.:||::.|...:....:::.|||........::..:...|..|    .:.|::.       
pombe   351 PAAEPASSTTSARDQTPSTPKDVGSPSTAETSAEEKQMETYKTPTHA----ALSDIISTHDYALD 411

  Fly   339 ---------APGSSPVASS 348
                     |...||:.||
pombe   412 ANSASQTKKAAFGSPIGSS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 44/93 (47%)
fkh2NP_596764.1 COG5025 6..622 CDD:227358 73/279 (26%)
FHA 81..185 CDD:238017
Forkhead 223..308 CDD:278670 44/93 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47009
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.