DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxa3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_038957314.1 Gene:Foxa3 / 25100 RGDID:2809 Length:361 Species:Rattus norvegicus


Alignment Length:380 Identity:116/380 - (30%)
Similarity:150/380 - (39%) Gaps:121/380 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SMLPDNEELVNSMLANPDYL--RTQVSP---NPLAPSAV------------GGAGMEGLMCGSFS 57
            :|.|.|..:..:.|::| |.  ..|.||   .||||.|.            .|:|..|...|..:
  Rat    40 TMAPLNSYMSLNPLSSP-YPPGGLQASPLPTGPLAPPAPTAPLGPTFPGLGAGSGTGGSASGYGA 103

  Fly    58 PAFYYQGIDSFLALHNNIWGLPISFLHNSHRP---EKPPFSYIALIAMAISSAPNQRLTLSGIYK 119
            |.   .|:     :|..      .......||   .|||:|||:||.|||..||.:.||||.||:
  Rat   104 PG---PGL-----VHGK------EMAKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQ 154

  Fly   120 FIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQG 184
            :|||.|||||||:|.|||||||:||.||||||:.|..      |..||||||.|..|:.:|||.|
  Rat   155 WIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSP------DKPGKGSYWALHPSSGNMFENG 213

  Fly   185 NYRRRRTRRQRHCGHPNRYERESGKDSNDGNS----------------SAAEIRSPSEPLSDFDI 233
            .|.||:.|.:.         .|..|..|...|                :|..:.||::|      
  Rat   214 CYLRRQKRFKL---------EEKAKKGNSATSATRNGTVGSATSATTTAATAVTSPAQP------ 263

  Fly   234 FCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIR---ECPDDVD----ASSSSSK 291
                                                 :|.|...   :..:||.    ||..||.
  Rat   264 -------------------------------------QPTPPSEPEAQSGEDVGGLDCASPPSSA 291

  Fly   292 AMQSSMELHEE--LHSPSAFTPP--LNRRETSSSGAP-VLAEAFNGIKDVVDAPG 341
            ...:.:||..|  |.:|..|..|  :|...:..:..| .|...|.|.......||
  Rat   292 PYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 58/93 (62%)
Foxa3XP_038957314.1 FH_FOXA3 124..225 CDD:410814 63/115 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.