DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxi2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:383 Identity:119/383 - (31%)
Similarity:156/383 - (40%) Gaps:126/383 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSCYANGSMLPDNEELVNSMLANPDYLRTQVSPNPLAPSAVGGAGMEGLMCGSFSPAFYYQGI-- 65
            |..|....:.......|||         |.:||.|..|    |.|          ||..|...  
  Rat    50 PPSYGRADLGSGRRLWVNS---------TALSPAPYTP----GPG----------PAPTYAAAAL 91

  Fly    66 ---DSFLALHNNIWGLPISFLHNSHRPE-----KPPFSYIALIAMAISSAPNQRLTLSGIYKFIM 122
               .|.|:....:.|..:::|..|.:.|     :||:||.|||||||.|||.:|||||.||:::.
  Rat    92 AVSGSLLSPSGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVA 156

  Fly   123 DKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYR 187
            ..||:|:.:|.||||||||||||||||.|:|||:|      ..|||:||.||.:...||:.||:|
  Rat   157 GNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEN------DPGKGNYWTLDPNCEKMFDNGNFR 215

  Fly   188 RRRTRRQR-------HCGHPNRYERE-SGKDSNDGNSSAAEIRSPSEP-----LSDFDIFCNERP 239
            |:|.||..       ....|.|...| ||..|.|..:|.    ||:.|     ||.|        
  Rat   216 RKRRRRGETSEAAVPGASRPERAALEPSGLVSQDLQTSP----SPTAPEAAACLSSF-------- 268

  Fly   240 NYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELH 304
                          |.:||  :|    |.|...||:  ..|.|..                    
  Rat   269 --------------STALG--AL----AGGFSTLPD--GLPQDFS-------------------- 291

  Fly   305 SPSAFTPPLNRRETSSSGAPVLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTIDNII 362
                    |.|..|.||..|.:...         :||..|   .:::..|.|.:.::|
  Rat   292 --------LRRPPTESSRRPQIPNT---------SPGFGP---GHQTGATGFRVGHLI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 55/93 (59%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 55/91 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.