DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxg1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_036692.1 Gene:Foxg1 / 24370 RGDID:2619 Length:480 Species:Rattus norvegicus


Alignment Length:220 Identity:91/220 - (41%)
Similarity:104/220 - (47%) Gaps:76/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            |||||||.|||.|||..:|.:||||:|||:|||..||||||||||||||||||||||.||||:||
  Rat   171 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPR 235

  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMF---EQGNYRRRRTRRQRHCG------------------ 198
                  ..|..|||:|||||.|:.|:|   ..|..|||.|..:....                  
  Rat   236 ------HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRA 294

  Fly   199 --------------HPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLH 249
                          ||    |.|...|.:|.:||    .||.|:.           ||..:|.  
  Rat   295 GSLYWPMSPFLSLHHP----RASSTLSYNGTTSA----YPSHPMP-----------YSSVLTQ-- 338

  Fly   250 RQYLSVSLGFNSLFNNE----ARGL 270
                      |||.||.    |.||
  Rat   339 ----------NSLGNNHSFSTANGL 353

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 63/96 (66%)