DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxi3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:345 Identity:109/345 - (31%)
Similarity:153/345 - (44%) Gaps:68/345 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SPNP-LAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWGLPISFLHNSHRPEKPPFSYI 97
            :|.| |.|.|..|. ..|...|...|:.......:..|....:..|.::...:..:..:||:||.
Mouse    72 APGPFLQPPAAPGT-FAGAQRGFAQPSASAPASPAGSAAPGELGWLSMASREDLMKMVRPPYSYS 135

  Fly    98 ALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDN 162
            |||||||.|||.::||||.||:|:.|.||:|:.:|.||||||||||||||||.|:|||:      
Mouse   136 ALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRDE------ 194

  Fly   163 DSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGH---PNRYERESGKDSNDGNSSAAEIRSP 224
            |..|||:||.||.:...||:.||:||:|.||.....:   |:...:..|:.|....|...|..||
Mouse   195 DDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVPSGTSKSEGQSSRLRVSGKLEGDSP 259

  Fly   225 SEPLSDFDIFCNERPNYSDR------------------ITDLHRQYLSVSLGFNSLFNNEARGL- 270
            |..|         ||:.|..                  .|.....:||.   ||:|..|.:..: 
Mouse   260 SSIL---------RPSQSPEPPEGTKSTASSPGASTLTSTPCLNTFLST---FNTLNVNSSSSMG 312

  Fly   271 --RPLPEIR------ECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLA 327
              |.||..|      :.|.....::|...:...||:|                  ::..|:..|:
Mouse   313 NQRTLPGSRRHLGGTQLPSSTFPNTSVPDSSPDSMQL------------------STVGGSNQLS 359

  Fly   328 EAFNGIKDVVDAPGSSPVAS 347
            ..:|..........|||.:|
Mouse   360 SYYNPFSGGSSGDQSSPFSS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 56/93 (60%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 56/91 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4419
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.