powered by:
Protein Alignment FoxL1 and FOXM1
DIOPT Version :9
Sequence 1: | NP_001246609.1 |
Gene: | FoxL1 / 38471 |
FlyBaseID: | FBgn0004895 |
Length: | 365 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_973731.1 |
Gene: | FOXM1 / 2305 |
HGNCID: | 3818 |
Length: | 801 |
Species: | Homo sapiens |
Alignment Length: | 90 |
Identity: | 41/90 - (45%) |
Similarity: | 59/90 - (65%) |
Gaps: | 10/90 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE-NKQGWQNSIRHNLSLNDCFVKIP 153
|:||:||:|:|..||:|...:|:||..||.:|.|.|||::. .|.||:|||||||||:|.||:
Human 235 ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVR-- 297
Fly 154 RDKNTIEDNDSAGKGSYWMLDSSAS 178
:..:.||.|:|.:..||:
Human 298 -------ETSANGKVSFWTIHPSAN 315
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
FoxL1 | NP_001246609.1 |
FH |
91..185 |
CDD:214627 |
40/89 (45%) |
FOXM1 | NP_973731.1 |
FH |
236..311 |
CDD:238016 |
38/83 (46%) |
Herpes_ICP4_C |
504..>749 |
CDD:332854 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2294 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1270467at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.