DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXC2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_005242.1 Gene:FOXC2 / 2303 HGNCID:3801 Length:501 Species:Homo sapiens


Alignment Length:355 Identity:108/355 - (30%)
Similarity:152/355 - (42%) Gaps:120/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PSAVG------------GAGMEGLMCGSFSPAFYYQGIDSFLALHNNIW--GLPISFL-HNSHRP 89
            |:|:|            .||..|   |..||...|.|       |...:  |:..|:. ::.|:|
Human    10 PNALGVVPYLSEQNYYRAAGSYG---GMASPMGVYSG-------HPEQYSAGMGRSYAPYHHHQP 64

  Fly    90 E------KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDC 148
            .      |||:||||||.|||.:||.:::||:|||:||||:||:|||||||||||||||||||:|
Human    65 AAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC 129

  Fly   149 FVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSND 213
            |||:||      |:...||||||.||..:.:|||.|::.|||.|.::             ||.:.
Human   130 FVKVPR------DDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKK-------------KDVSK 175

  Fly   214 GNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRE 278
            .....|.::.|....|                                      :|....|.:.:
Human   176 EKEERAHLKEPPPAAS--------------------------------------KGAPATPHLAD 202

  Fly   279 CPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSS-----SGAPVLAEAFNGIKDVVD 338
            .|          |..:..:.:..|..||:  .|.:.:.||.|     .|:|         :....
Human   203 AP----------KEAEKKVVIKSEAASPA--LPVITKVETLSPESALQGSP---------RSAAS 246

  Fly   339 APGSSPVASSNRSKTTL------FTIDNII 362
            .|..||..|........      |:::||:
Human   247 TPAGSPDGSLPEHHAAAPNGLPGFSVENIM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 62/93 (67%)
FOXC2NP_005242.1 FH 72..160 CDD:214627 62/93 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..208 10/101 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..268 7/44 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.